PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC05G14270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 837aa    MW: 91817.2 Da    PI: 6.1515
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC05G14270.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1117.5e-35166240276
                      -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
              SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                      Cqv+gC+ad+ e+k yhrrh+vC  +++a++v+++g+++r+CqqC++fh l +fDe+krsCrr+L++hn+rrr+k
  OPUNC05G14270.1 166 CQVPGCDADIRELKGYHRRHRVCLRCAHAAAVMLDGVQKRYCQQCGKFHILLDFDEDKRSCRRKLERHNKRRRRK 240
                      ************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.4E-27159227IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.47163240IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.35E-33164243IPR004333Transcription factor, SBP-box
PfamPF031105.3E-27166240IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 837 aa     Download sequence    Send to blast
MDAPGGGGGA DAGEPVWDWG NLLDFAVHDD DSLVLPWGDD SIGIEADPAE AALLPPAPSP  60
QPVEAEAEVE AEGPASLPSS MQAEGSKRRV RKRDPRLVCP NYLAGRVPCA CPEVDEMAAA  120
LEVEDVATEL LAGARKKPKG AGRGSGAAAG GSGGGASRGT PSEMKCQVPG CDADIRELKG  180
YHRRHRVCLR CAHAAAVMLD GVQKRYCQQC GKFHILLDFD EDKRSCRRKL ERHNKRRRRK  240
PDSKGILEKD VYDQLDLSAD GSGDGELREE NIDVTTSETL ETVLSNKVLD RETPVGSDDV  300
LSSPTCAQPS LQIDQSKSLV TFAASVEACL GAKQENTKLT NSPVHDTKST YSSSCPTGRV  360
SFKLYDWNPA EFPRRLRHQI FEWLSSMPVE LEGYIRPGCT ILTVFVAMPQ HMWDKLSEDT  420
ANLVKSLVNA PNSLLLGKGA FFIHVNNMIF QVLKDGATLT STRLEVQSPR IHYVHPSWFE  480
AGKPVDLILC GSSLDQPKFR SLVSFDGLYL KHDCCRILSH ETFDYIGSGE HILDSQHEIF  540
RINITASKLD THGPAFVEVE NMFGLSNFVP ILVGSKHLCS ELEQIHDALC GSSDISSEPC  600
ELRGHRQTAM SGFLTDIGWL IRKPSVDEFQ NLLSLANIQR WICMVKFLIQ NDFINVLEII  660
VNSLDNIIGS EVLSNLEKGR LENHVTEFLG YVSEARNIVH NRPKYDKQTQ IDTRWAGDYA  720
PNQPKLGISV PLAESTGTSG EHDLHSTNAA SGEEENMPLM TKALPHRQCC HPEISARWLN  780
PASVGAFPGG AMRMRLATTV VIAAVLCFAA CVVLFHPHRV GVLAAPVKRY LSRNYSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A5e-37162245285squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222240KRSCRRKLERHNKRRRRKP
2226238RRKLERHNKRRRR
3233240NKRRRRKP
4234239KRRRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1000570.0AK100057.1 Oryza sativa Japonica Group cDNA clone:J013158B16, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015640052.10.0PREDICTED: squamosa promoter-binding-like protein 9
SwissprotQ6I5760.0SPL9_ORYSJ; Squamosa promoter-binding-like protein 9
TrEMBLA0A0E0L2G30.0A0A0E0L2G3_ORYPU; Uncharacterized protein
STRINGLOC_Os05g33810.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69223344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.21e-146squamosa promoter binding protein-like 7